PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr11P02410_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family MYB
Protein Properties Length: 213aa    MW: 24513.3 Da    PI: 6.0487
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr11P02410_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.92e-171764148
                            TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
         Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                            +g+WT++Ed+ll + v+++G g W+++++  g++R++k+c++rw +yl
  GSMUA_Achr11P02410_001 17 KGPWTAQEDKLLMEHVNLHGEGKWNSVSKLTGLRRSGKSCRLRWVNYL 64
                            79********************************************97 PP

2Myb_DNA-binding51.62.2e-1670114147
                             TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
         Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                             rg+ Tt+E+ ++ ++++++G++ W+tIar ++ gRt++++k++w+++
  GSMUA_Achr11P02410_001  70 RGNITTQEENIIQELHALWGNR-WSTIARSLP-GRTDNEIKNYWRTH 114
                             7999******************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.1E-221167IPR009057Homeodomain-like
PROSITE profilePS5129416.8741264IPR017930Myb domain
SuperFamilySSF466891.98E-2914111IPR009057Homeodomain-like
SMARTSM007177.8E-151666IPR001005SANT/Myb domain
PfamPF002498.3E-171764IPR001005SANT/Myb domain
CDDcd001672.40E-101964No hitNo description
PROSITE profilePS5129423.47465119IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.0E-2368118IPR009057Homeodomain-like
SMARTSM007178.4E-1569117IPR001005SANT/Myb domain
PfamPF002498.3E-1470114IPR001005SANT/Myb domain
CDDcd001671.68E-974115No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 213 aa     Download sequence    Send to blast
MDAKFGLGTL DNEGWKKGPW TAQEDKLLME HVNLHGEGKW NSVSKLTGLR RSGKSCRLRW  60
VNYLRPDLKR GNITTQEENI IQELHALWGN RWSTIARSLP GRTDNEIKNY WRTHFKKSKP  120
SKNVEKARAR FLIRQRLEDQ QHQDAEQQQA DVRAFMEQAE EATPVEDMEE MTYLNSVTFM  180
LPGGGFDGYL SDGSTEEGSW GTLWNLADAP DDT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C1e-251711827127MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009382194.11e-159PREDICTED: myb-related protein 340-like
SwissprotQ4JL843e-48MYB59_ARATH; Transcription factor MYB59
TrEMBLM0RNS11e-159M0RNS1_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr11P02410_0011e-159(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP32433584
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G13480.12e-65myb domain protein 79